PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D01905.1.p
Common NameEUGRSUZ_D01905
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 662aa    MW: 73158.2 Da    PI: 9.5991
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D01905.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-18166211248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       grWT+eEd +l+ av+++  ++WktIa++++ g+t+ qc +rw+k+l
  Eucgr.D01905.1.p 166 GRWTKEEDRILIAAVQKFNCKNWKTIAACVP-GKTDSQCLHRWRKVL 211
                       8******************************.************986 PP

2Myb_DNA-binding48.91.5e-15217262148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+W + Ed+ll++ vk++G + W++Ia+t++ gRt+kqc++rw ++l
  Eucgr.D01905.1.p 217 KGSWIKGEDDLLINSVKRYGCK-WSLIAKTFP-GRTGKQCRERWTNHL 262
                       6899999*************99.*********.************996 PP

3Myb_DNA-binding51.62.2e-16268310145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WT+eE+ +l++ ++ +G++ W+ Ia+ ++ gRt++ +k++w+
  Eucgr.D01905.1.p 268 KVAWTAEEESILAHWHHIYGNK-WAQIAKFLP-GRTDNAIKNHWN 310
                       568*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.615160211IPR017930Myb domain
SuperFamilySSF466892.09E-17164225IPR009057Homeodomain-like
SMARTSM007176.4E-16164213IPR001005SANT/Myb domain
PfamPF002495.4E-16166211IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-18166215IPR009057Homeodomain-like
CDDcd001672.76E-15167211No hitNo description
PROSITE profilePS5129425.08212266IPR017930Myb domain
SuperFamilySSF466894.03E-28214309IPR009057Homeodomain-like
SMARTSM007172.3E-13216264IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-20216251IPR009057Homeodomain-like
CDDcd001674.03E-11219262No hitNo description
PfamPF139217.0E-16220277No hitNo description
Gene3DG3DSA:1.10.10.602.3E-28252310IPR009057Homeodomain-like
SMARTSM007177.3E-16267315IPR001005SANT/Myb domain
PROSITE profilePS5129419.036267317IPR017930Myb domain
CDDcd001671.91E-12270310No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MFLLSFFFLL QRLTQASTFT LSRCLSLSSP PTKLRREAHG KIGFLNSNTP PISPAELHTS  60
LCTYIYGLSR RSLRSRIPHF PATISSCFAW FPRLGFGVPP LSAAVRSRKP RGILSSSMVR  120
VKEEYDVVAT PSFFNGSCDS YPKKSLSTLS YSSRRAIGPI RRSTGGRWTK EEDRILIAAV  180
QKFNCKNWKT IAACVPGKTD SQCLHRWRKV LDPRLIKGSW IKGEDDLLIN SVKRYGCKWS  240
LIAKTFPGRT GKQCRERWTN HLNPSVKKVA WTAEEESILA HWHHIYGNKW AQIAKFLPGR  300
TDNAIKNHWN CSMKKRLGSW STGCIMEMSD ASSEFCSPEV KADCSMVKLE RQSADEITSV  360
DQRMHLDLNR SCFTDFTSEY SHGGIMESEA VNCCISRAPW HSTAGANSRG YPTANPFHVA  420
TGFSGDADSG SNISVSSLAD PSSIGACSTV ELTPSPVKVN LSFASQSFES PKRIRVGATN  480
TKCGDDPGYF CSTPSKSTDM DFTGADKRKN VSDMLSSALQ LRDPVTLVAN NGFTGVEKQC  540
SPSRTSYYLS TPPNSVSSVS VKSWSPELIL RKLAMTYEHT PSIIRRRCSK NSGDASYSGS  600
ASTPALMLSN SQEKEGGSVD FLHVERGLLL NLHNARISTA AKCLERRLEH AFDMEMDTAI  660
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-581663178159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-581663178159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D01905.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053317.10.0PREDICTED: myb-related protein B-like
RefseqXP_010053316.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A059CH750.0A0A059CH75_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2070356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.23e-70myb domain protein 3r-5